.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kye

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Roadblock/LC7 Domain from Streptomyces avermitilis. To be Published
    Site MCSG
    PDB Id 3kye Target Id APC65472.1
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS31515,NP_822808.1, 3.30.450.110, 227882 Molecular Weight 13171.35 Da.
    Residues 126 Isoelectric Point 5.37
    Sequence hvsdldwlmsglvqrvphttsavllscdglvksvhgldpdsadhmaalasglyslgrsagirfgdggdv rqvvveldstllfvstagsgtclavlagreadaavlgyemamlvksvrpylmtaprq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.227
    Matthews' coefficent 1.95 Rfactor 0.186
    Waters 153 Solvent Content 36.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kye
    1. Structural characterization of HBXIP: the protein that interacts with the anti-apoptotic protein survivin and the oncogenic viral protein HBx
    I Garcia-Saez, FB Lacroix, D Blot, F Gabel - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch