.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the sensor domain of two-component sensor PfeS from Pseudomonas aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3kyz Target Id APC37897.4
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS31445,NP_251377.1, 208964 Molecular Weight 13945.94 Da.
    Residues 122 Isoelectric Point 5.56
    Sequence wglsverstyflapadrhyladyarqaedawrregaagaerfrkelsakedtwvalvgphleslgstpl saeesshltfmrkldwpmsrrlqdelpyvsiefpghpeqgrlviqlperllpg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.1811
    Matthews' coefficent 2.58 Rfactor 0.1511
    Waters 149 Solvent Content 52.33

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch