The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3kzq Target Id APC61808.2
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS31477,BAC60379.1,, 223926 Molecular Weight 23932.36 Da.
    Residues 208 Isoelectric Point 5.10
    Sequence mniklyyvhdpmcswcwgykptieklkqqlpgviqfeyvvgglapdtnlpmppemqqklegiwkqietq lgtkfnydfwklctpvrstyqscraviaagfqdsyeqmleaiqhayylramppheeathlqlakeigln vqqfkndmdgtllegvfqdqlslakslgvnsypslvlqindayfpievdylsteptlklireriienmsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.21836
    Matthews' coefficent 3.66 Rfactor 0.17935
    Waters 964 Solvent Content 66.43

    Ligand Information
    Ligands PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 6;GOL (GLYCEROL) x 8
    Metals MG (MAGNESIUM) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch