The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site MCSG
    PDB Id 3l0z Target Id APC63339
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS31490,AAB99619.1,, 243232 Molecular Weight 37797.98 Da.
    Residues 350 Isoelectric Point 8.66
    Sequence msiiainengfldkikgrnplftcvissiettlsipisgvhrdvikytpsadvelvfygksltlktppi datgsptpatitracvelkniknlhidagafvkpkipfieidekptgrieegkamnnskelymkgyllg knldaellivgesvpggtttalgvllglgydaegkvssgsinnphelkikvvreglkkaginekssvfd vlnavgdkmmpvvaglaisfaernkpvilaggtqmsavlavikeinkkvldknliaigttefvlndkkg dlkgiveqignvpvlaskfyfekakieglknyckgsvkegvgaggiavysivndleptkirefienkfy ewyke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.65 Rfree 0.26175
    Matthews' coefficent 3.06 Rfactor 0.20219
    Waters 9 Solvent Content 59.74

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch