.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l52

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative orotidine 5'-phosphate decarboxylase from Streptomyces avermitilis MA-4680. To be Published
    Site MCSG
    PDB Id 3l52 Target Id APC65463
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS31514,NP_828045.1, 3.20.20.70, 227882 Molecular Weight 28931.00 Da.
    Residues 280 Isoelectric Point 5.01
    Sequence mslepfgarlsramddrgplcvgidphaslladwglsddvaglerfsrtvvealgehvavfkpqsaffe rfgsrgvavlektvaearaagalvvmdakrgdigstmaayaeaflrkdsplfsdaltvspylgygslrp avelaresgaglfvlaltsnpeggevqhavrtdgrdvaatmlahlaaenageeplgsfgavvgatlgdl ssydldingpllapgigaqgaapadlpgvfgaavrnvvpnvsrgvlrhgpdvralrtaadrfaeeiraa vaav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.1869
    Matthews' coefficent 2.26 Rfactor 0.1757
    Waters 289 Solvent Content 45.46

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals NA (SODIUM) x 11

    Jmol

     
    Google Scholar output for 3l52
    1. Molecular characterization of Mtb-OMP decarboxylase by modeling, docking and dynamic studies
    P Madhusudana, B Babajan, M Chaitanya - Interdisciplinary , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch