.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l53

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3l53 Target Id APC40664
    Molecular Characteristics
    Source Oleispira antarctica
    Alias Ids TPS31460,OLEI04334_1_224, 188908 Molecular Weight 23978.11 Da.
    Residues 224 Isoelectric Point 4.91
    Sequence maelilnqrpyprdlgkivcvgrnyaahakelnnpipsspilfikpassavpfgpvfsipkdqgsvhhe leiailigkalsrasteqvaesiagiglgldltlrdvqdqlkekghpweraksfdgacpltefvavnla sedewqaigltlekngqfqqqgssaemlfpilpliahmsehfslqpgdviltgtpagvgplevgdslsa klslednvlltcdgvvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.10 Rfree 0.25357
    Matthews' coefficent 2.53 Rfactor 0.19204
    Waters 1010 Solvent Content 51.40

    Ligand Information
    Ligands TAR (D(-)-TARTARIC) x 8;ACT (ACETATE) x 6;NH4 (AMMONIUM) x 3
    Metals ZN (ZINC) x 13

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch