.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l55

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative beta-1,4-endoglucanase / cellulase from Prevotella bryantii. To be Published
    Site MCSG
    PDB Id 3l55 Target Id APC40456
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS31455,JGI0202_1_353, 70601 Molecular Weight 39353.73 Da.
    Residues 353 Isoelectric Point 4.67
    Sequence minqnatymeesaqsavdnfglgfnlgntldangcgtgkpvatyetfwgqpettqdmmtflmqngfnav ripvtwyehmdaegnvdeawmmrvkaiveyamnaglyaivnvhhdtaagsgawikadtdvyaatkekfk klwtqianaladydqhllfegynemldgnnswdepqkasgyealnnyaqdfvdavratggnnatrnliv ntyaaakgenvlnnfmlptdavnnhlivqvhsydpwnffntkttwdsechntlteifsalskkfttipy iigeygthgesdisvsksspaekiklaadqaadmvklakdhhsatfywmsifdgsdriqpqwslptvve amqeaynn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2193
    Matthews' coefficent 2.17 Rfactor 0.1909
    Waters 861 Solvent Content 43.41

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 7;CA (CALCIUM) x 7

    Jmol

     
    Google Scholar output for 3l55
    1. Study and design of stability in GH5 cellulases
    S Badieyan, DR Bevan, C Zhang - Biotechnology and , 2012 - Wiley Online Library
     
    2. A salt-bridge controlled by ligand binding modulates the hydrolysis reaction in a GH5 endoglucanase
    S Badieyan, DR Bevan, C Zhang - Protein Engineering Design , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch