.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l5z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator, GntR family from Bacillus cereus. To be Published
    Site MCSG
    PDB Id 3l5z Target Id APC37964.1
    Related PDB Ids 3lhe 
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS31447,AAS42332.1, PF07702.3.HMM.4, 222523 Molecular Weight 17412.14 Da.
    Residues 153 Isoelectric Point 5.00
    Sequence vygseveskiieftivgadeiiaeklgisvgdfvykiirlriihsiptimehtwmpiavipgveasvle esiysyiqnklglkvgtsvvrvkgirpddkekqfmnltnqdflmrveqvayltdgrtfeysyadhlpet fefetvitaksykea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.24324
    Matthews' coefficent Rfactor 0.20355
    Waters 49 Solvent Content

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch