.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the C-terminal domain from a Streptococcus mutans hypothetical. To be Published
    Site MCSG
    PDB Id 3l9a Target Id APC40171
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS48604,BAF47173.1, 1309 Molecular Weight 26918.01 Da.
    Residues 239 Isoelectric Point 6.31
    Sequence mvkksyvinwardlanrgvgvnydgafgsqcvdlpfwilgkffgrpisgnaidllnsakaagyqviyda pgvnprvgdifvmhsiaydgkdyghtglviedsdghsiktieqnvdgnadnlyvggparyrtrsfngii gwirppyeneilenkreetdmrdffvitnseytfagvhyakgavlhvsptqkrafwviadqenfikqvn knieyveknaspaflqriveiyqvkfegknvh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.15490
    Matthews' coefficent 1.98 Rfactor 0.13354
    Waters 136 Solvent Content 37.75

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3l9a
    1. X-ray crystal structure of the streptococcal specific phage lysin PlyC
    S McGowan, AM Buckle, MS Mitchell - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch