.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lab

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase from Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3lab Target Id APC40663
    Molecular Characteristics
    Source Oleispira antarctica
    Alias Ids TPS31459,OLEI03018_1_216, 188908 Molecular Weight 22731.19 Da.
    Residues 216 Isoelectric Point 5.22
    Sequence mtqldtwlantkplipvividdlvhaipmakalvaggvhllevtlrteaglaaisaikkavpeaivgag tvctaddfqkaidagaqfivspgltpeliekakqvkldgqwqgvflpgvatasevmiaaqagitqlkcf pasaiggakllkawsgpfpdiqfcptggiskdnykeylglpnvicaggswltesklliegdwnevtrra seivklsdi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.21502
    Matthews' coefficent 2.93 Rfactor 0.17088
    Waters 438 Solvent Content 58.00

    Ligand Information
    Ligands PYR (PYRUVIC) x 2;IPA (ISOPROPYL) x 1
    Metals CL (CHLORIDE) x 4;NA (SODIUM) x 20

    Jmol

     
    Google Scholar output for 3lab
    1. Studies of benzothiadiazine derivatives as hepatitis C virus NS5B polymerase inhibitors using 3D-QSAR, molecular docking and molecular dynamics
    X Wang, W Yang, X Xu, H Zhang, Y Li - Current medicinal , 2010 - ingentaconnect.com
     
    2. Insights into the mechanism of type I dehydroquinate dehydratases from structures of reaction intermediates
    SH Light, G Minasov, L Shuvalova, ME Duban - Journal of Biological , 2011 - ASBMB
     
    3. Molecular Modeling and Affinity Determination of scFv Antibody: Proper Linker Peptide Enhances Its Activity
    X Gu, X Jia, J Feng, B Shen, Y Huang, S Geng - Annals of biomedical , 2010 - Springer
     
    4. Insight into the Structural Requirements of Benzothiadiazine Scaffold-Based Derivatives as Hepatitis C Virus NS5B Polymerase Inhibitors Using 3D-QSAR, Molecular
    HX Zhang, Y Li, X Wang, ZT Xiao - Current medicinal , 2011 - ingentaconnect.com
     
    5. PHARMACOPROTEOMIC ANALYSIS OF THREE DIFFERENT CHONDROITIN SULFATE COMPOUNDS IN HUMAN CHONDROCYTES CULTURES
    I SITES - IEEE/ACM Trans Comput Biol Bioinform, 2011 - eupa.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch