The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Enoyl-CoA Hydratase from Pseudomonas aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3lao Target Id APC37788.1
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS31442,NP_249931.1, 208964 Molecular Weight 27460.62 Da.
    Residues 255 Isoelectric Point 5.08
    Sequence mseansgpgrvtreqrghlfligldragkrnafdsamladlalamgeyerseesrcavlfahgehftag ldlmelapklaasgfrypdggvdpwgvvqprrskplvvavqgtcwtagielmlnadiavaargtrfahl evlrgipplggstvrfpraagwtdamryiltgdefdadealrmrlltevvepgeelaraleyaeriara aplavraalqsafqgrdegddaalsrvneslaaligsedvregvlamv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.40 Rfree 0.2390
    Matthews' coefficent 2.10 Rfactor 0.172
    Waters 238 Solvent Content 41.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch