.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lax

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482. To be Published
    Site MCSG
    PDB Id 3lax Target Id APC62324.1
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS26910,ABR39349.1, 3.30.300.30, 435590 Molecular Weight 12091.41 Da.
    Residues 106 Isoelectric Point 5.01
    Sequence ddmiilkgvnifpiqietillqfkelgsdylitletaesndemtvevelsqlftddygrlqaltreitr qlkdeilvtprvklvpkgalpksegkavrvkdlrktf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.43 Rfree 0.2253
    Matthews' coefficent 2.03 Rfactor 0.1743
    Waters 90 Solvent Content 39.31

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lax
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch