.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ldu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a possible methylase from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3ldu Target Id APC62646
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS31484,CAJ68650.1, 3.40.50.150, 272563 Molecular Weight 44395.55 Da.
    Residues 382 Isoelectric Point 8.55
    Sequence mknytlispcffgmekmlareitnlgyeiiktedgrityktdefgiaksnmwlrcaervhlkiaefeak sfdelfentkrinwsryipygaqfpiskassiksklystpdvqaivkkaiveslkksyledgllkedke kypifvfihkdkvtisidttgdalhkrgyrekankapiretlaagliyltpwkagrvlvdpmcgsgtil ieaamiginmapglnrefisekwrtldkkiwwdvrkdafnkidneskfkiygydideesidiarenaei agvdeyiefnvgdatqfksedefgfiitnppygerledkdsvkqlykelgyafrklknwsyylitsyed feyefgqkadkkrklyngmlktnffqypgpkpprnnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2105
    Matthews' coefficent 2.14 Rfactor 0.1723
    Waters 206 Solvent Content 42.64

    Ligand Information
    Ligands GTP (GUANOSINE-5'-TRIPHOSPHATE) x 1;FMT (FORMIC) x 2;GOL (GLYCEROL) x 9
    Metals

    Jmol

     
    Google Scholar output for 3ldu
    1. Crystallization and preliminary X-ray crystallographic analysis of putative tRNA-modification enzymes from Pyrococcus furiosus and Thermus thermophilus
    M Fislage, M Roovers, S Munnich - Section F: Structural , 2011 - scripts.iucr.org
     
    2. Crystal structures of the tRNA: m2G6 methyltransferase Trm14/TrmN from two domains of life
    M Fislage, M Roovers, I Tuszynska - Nucleic Acids , 2012 - Oxford Univ Press
     
    3. Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
    KT Wang, B Desmolaize, J Nan, XW Zhang - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch