The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Roadblock/LC7 domain from Streptomyces avermitillis to 1.85A. To be Published
    Site MCSG
    PDB Id 3leq Target Id APC65473.1
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS31516,NP_823365.1, 3.30.450.110, 227882 Molecular Weight 13305.67 Da.
    Residues 126 Isoelectric Point 6.84
    Sequence thsqldqlltglvdrvaevdhavvlsedglvvskstgflrddaerlaatasglmslskgvsmdfrrgpv rqaliemgkgyliltaagpgahlvvltrqgadvgvvayqmnmlvkkigehlsapprg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.23588
    Matthews' coefficent 1.94 Rfactor 0.21592
    Waters 37 Solvent Content 36.52

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch