.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lfr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a CBS Domain from a Putative Metal Ion Transporter Bound to AMP from Pseudomonas syringae to 1.55A. To be Published
    Site MCSG
    PDB Id 3lfr Target Id APC84899.1
    Molecular Characteristics
    Source Pseudomonas syringae pv. tomato str. dc3000
    Alias Ids TPS31518,AAO58236.1, 3.20.20.70, 223283 Molecular Weight 15014.36 Da.
    Residues 135 Isoelectric Point 4.76
    Sequence dlqvrdimvprsqmisikatqtpreflpavidaahsrypvigeshddvlgvllakdllplilkadgdsd dvkkllrpatfvpeskrlnvllrefranhnhmaivideyggvaglvtiedvleqivgdiedehdve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.53 Rfree 0.212
    Matthews' coefficent 1.91 Rfactor 0.175
    Waters 172 Solvent Content 35.60

    Ligand Information
    Ligands AMP (ADENOSINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3lfr
    1. Mutational analysis of residues in the regulatory CBS domains of Moorella thermoacetica pyrophosphatase corresponding to disease-related residues of human
    R Lahti, J Jmsen, H Tuominen, AA Baykov - 2011 - tara.tcd.ie
     
    2. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    3. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    4. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch