.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lhh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of CBS domain protein from Shewanella oneidensis MR-1. To be Published
    Site MCSG
    PDB Id 3lhh Target Id APC65307.2
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS31512,NP_718390.1, 211586 Molecular Weight 18816.38 Da.
    Residues 168 Isoelectric Point 4.40
    Sequence lddnvtqediqamlqegssagviehnehamvknvfrldertisslmvprsdivfldlnlpldanlrtvm qsphsrfpvcrnnvddmvgiisakqllsesiagerlelvdlvkncnfvpnslsgmellehfrttgsqmv fvvdeygdlkglvtlqdmmdaltgeffqed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2653
    Matthews' coefficent 2.15 Rfactor 0.2000
    Waters 39 Solvent Content 42.66

    Ligand Information
    Ligands AMP (ADENOSINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lhh
    1. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    2. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    3. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch