.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lk7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of UDP-N-acetylmuramoylalanine-D-glutamate (MurD) ligase from Streptococcus agalactiae to 1.5A. To be Published
    Site MCSG
    PDB Id 3lk7 Target Id APC89407
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v
    Alias Ids TPS33286,AAM99377.1, 3.40.50.300.6, 208435 Molecular Weight 48930.17 Da.
    Residues 451 Isoelectric Point 5.42
    Sequence mktittfenkkvlvlglarsgeaaarllaklgaivtvndgkpfdenptaqslleegikvvcgshplell dedfcymiknpgipynnpmvkkalekqipvltevelaylvsesqligitgsngktttttmiaevlnagg qrgllagnigfpasevvqaandkdtlvmelssfqlmgvkefrphiavitnlmpthldyhgsfedyvaak wniqnqmsssdflvlnfnqgiskelakttkativpfsttekvdgayvqdkqlfykgenimsvddigvpg shnvenalatiavaklagisnqviretlsnfggvkhrlqslgkvhgisfyndskstnilatqkalsgfd ntkviliaggldrgnefdelipditglkhmvvlgesasrvkraaqkagvtysdaldvrdavhkayevaq qgdvillspanaswdmyknfevrgdefidtfeslrge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.208
    Matthews' coefficent 2.71 Rfactor 0.187
    Waters 401 Solvent Content 54.60

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3lk7
    1. Peptidoglycan biosynthesis machinery: A rich source of drug targets
    A Gautam, R Vyas, R Tewari - Critical Reviews in , 2011 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch