.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lkl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain of Anti-Sigma factor antagonist STAS from Rhodobacter sphaeroides. To be Published
    Site MCSG
    PDB Id 3lkl Target Id APC63695.3
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS33276,ABA81784.1, 3.30.750.24, 272943 Molecular Weight 10725.54 Da.
    Residues 95 Isoelectric Point 4.96
    Sequence favsselsacgrartyrvegqlfygsvedfmaafdfreplervtidvsrahiwdissvqaldmavlkfr regaevrivgmneasetlvdrlalhd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.24180
    Matthews' coefficent 2.94 Rfactor 0.19946
    Waters 82 Solvent Content 58.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch