The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961. To be Published
    Site MCSG
    PDB Id 3lkv Target Id APC87022.1
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS5873,AAF94260.1, BIG_542.1, 243277 Molecular Weight 31183.05 Da.
    Residues 299 Isoelectric Point 5.24
    Sequence imaktakvavsqivehpaldatrqglldglkakgyeegknlefdyktaqgnpaiavqiarqfvgenpdv lvgiatptaqalvsatktipivftavtdpvgaklvkqleqpgknvtglsdlspveqhvelikeilpnvk sigvvynpgeanavslmellklsaakhgiklveatalksadvqsatqaiaeksdviyalidntvasaie gmivaanqaktpvfgaatsyvergaiaslgfdyyqigvqtadyvaailegkepgsldvqvakgsdlvin ktaaeqlgitipeavlaratstk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.20339
    Matthews' coefficent 3.93 Rfactor 0.17835
    Waters 111 Solvent Content 68.74

    Ligand Information
    Ligands PHE (SULFATE) x 1;SO4 (GLYCEROL) x 1;GOL x 1
    Metals ZN (ZINC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch