.
The Open Protein Structure Annotation Network
PDB Keyword
.

3llv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the NAD(P)-binding domain of an Exopolyphosphatase-related protein from Archaeoglobus fulgidus to 1.7A. To be Published
    Site MCSG
    PDB Id 3llv Target Id APC62008.1
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS33271,AAB89226.1, 3.40.50.720, 224325 Molecular Weight 15402.77 Da.
    Residues 141 Isoelectric Point 4.69
    Sequence mtengryeyivigseaagvglvreltaagkkvlavdkskekielledegfdaviadptdesfyrsldle gvsavlitgsddefnlkilkalrsvsdvyaivrvsspkkkeefeeaganlvvlvadavkqafmdkikkm etl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.235
    Matthews' coefficent 2.27 Rfactor 0.210
    Waters 59 Solvent Content 45.90

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch