.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lp5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative cell surface hydrolase from Lactobacillus plantarum WCFS1. To be Published
    Site MCSG
    PDB Id 3lp5 Target Id APC60678.2
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS33263,CAD63681.1, 3.40.50.1820, 220668 Molecular Weight 28011.37 Da.
    Residues 249 Isoelectric Point 9.38
    Sequence trmapvimvpgssasqnrfdslitelgketpkkhsvlkltvqtdgtikysgsiaandnepfivigfann rdgkanidkqavwlntafkalvktyhfnhfyalghsnggliwtlflerylkespkvhidrlmtiaspyn meststtaktsmfkelyryrtglpesltvysiagtenytsdgtvpynsvnygkyifqdqvkhfteitvt gantahsdlpqnkqivslirqyllaetmpdkvrqknaqrvqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23647
    Matthews' coefficent 2.17 Rfactor 0.17462
    Waters 154 Solvent Content 43.31

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch