.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lr1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the tungstate ABC transporter from Geobacter sulfurreducens. To be Published
    Site MCSG
    PDB Id 3lr1 Target Id APC62934.2
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS33274,AAR36072.1, 3.40.190.10, 243231 Molecular Weight 25344.92 Da.
    Residues 233 Isoelectric Point 9.13
    Sequence eerlkmstttstqdsgllkvllppfekknnvkvdviavgtgqalklgeagdvdvvfvharkledkfvad gfgvnrkdvmyndfvivgpkndpagiakaktaaealkllatkgatfisrgdksgthtkeldlwksagvd pkgnwyveagqgmgpvitmaterraytltdrgtynafkgaktdlvilfqgekglfnpygimavnpkkfp hvkydlamklidyvtgpeglkiisdy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.26527
    Matthews' coefficent 2.16 Rfactor 0.18106
    Waters 173 Solvent Content 42.96

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals W (TUNGSTEN) x 2

    Jmol

     
    Google Scholar output for 3lr1
    1. Cellular uptake of molybdenum and tungsten
    WR Hagen - Coordination Chemistry Reviews, 2011 - Elsevier
     
    2. Classification of a Haemophilus influenzae ABC Transporter HI1470/71 through Its Cognate Molybdate Periplasmic Binding Protein, MolA
    L Tirado-Lee, A Lee, DC Rees, HW Pinkett - Structure, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch