.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of fatty acid binding DegV family protein SAG1342 from Streptococcus agalactiae. To be Published
    Site MCSG
    PDB Id 3lup Target Id APC20804
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v
    Alias Ids TPS33113,AAN00213.1, 208435 Molecular Weight 31103.03 Da.
    Residues 282 Isoelectric Point 5.01
    Sequence mklalitdtsaylpeaienhedvyvldipiiidgktyiegqnltldqyydklaaskelpktsqpslael ddllcqlekegythvlglfiaagisgfwqniqflieehpnltiafpdtkitsapqgnlvrnalmcsreg mdfdvivnkiqsqiekiegfivvndlnhlvkggrlsngsaiignllsikpvlhfneegkivvyekvrte kkalkrlaeivkemtadgeydiaiihsraqdkaeqlynllakaglkddleivsfggviathlgegavaf gitpkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.26525
    Matthews' coefficent 2.29 Rfactor 0.19727
    Waters 42 Solvent Content 46.36

    Ligand Information
    Ligands ELA (9-OCTADECENOIC) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch