.
The Open Protein Structure Annotation Network
PDB Keyword
.

3luy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative chorismate mutase from Bifidobacterium adolescentis. To be Published
    Site MCSG
    PDB Id 3luy Target Id APC38059
    Molecular Characteristics
    Source Bifidobacterium adolescentis atcc 15703
    Alias Ids TPS33246,BAF39848.1, PF00800.8.HMM.1, 367928 Molecular Weight 35782.47 Da.
    Residues 326 Isoelectric Point 4.82
    Sequence msarklfylgpqgtfthqaavnaaqelarfepqgfdlmpmddvpqildaaqhgdgwgivawennvegyv vpnldalidakdlvgfarvgvnvefdayvaqgadpaeariatahphglaqckrfiaehrlstqpatsna aacrdlipgeiafgpaicgelyditrigtaiqdyqgaatdflvlspraevarllakpraeanveyesvl tliplvtgpgvlanlldvfrdaglnmtsfisrpikgrtgtysfivtldaapweerfrdalveiaehgdw aktlavyprrehpnppvtswmlpqggvrlddshlpddwqndetvrrelmw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.225
    Matthews' coefficent 2.57 Rfactor 0.192
    Waters 138 Solvent Content 52.12

    Ligand Information
    Ligands PPY (3-PHENYLPYRUVIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3luy
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch