.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A. To be Published
    Site MCSG
    PDB Id 3lvt Target Id APC29172
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5434,AAO81483, 226185 Molecular Weight 102238.72 Da.
    Residues 896 Isoelectric Point 4.91
    Sequence mtkkkvyivshshwdrewylpyeehhmrlielvdnvldliendpefnsfhldgqtiilddylqvrpekk eavkkavqagklkigpfyilqddflissesnvrnmlighlesqkwgapvqlgyfpdtfgnmgqtpqmmq lanlpaaafgrgvkpigfdnqvlesdyssqysemwwegpdqtkifgllfanwysngneipsekeaaiaf wkqkladveryastnhllmmngvdhqpvqrditkaialanelfpeyefihsnfddylkavqeelpedlg tvtgeltsqetdgwytlantssarvylkqwntkvqrqleniaeplaamayevtgdyphdqfdyawktll qnhphdsicgcsvdevhrgmmtrfenandvghfladeatrqlteaidtsvfpekahpfvlfntsgyqkt evvtveveierlpfytgkpedlyhelkqkatpdyqvidptgkavasrivkedvrfgydlpkdafrqpym akyltvelsvkemapfswdsfaliqgetkafegsllaqpatnemenefiqvkienngsltiadkktget fsklltfedtgdigneyiffkptedqgittenvtaeitnkenspvkasyqikqtvmlpvaaderleeeq kavrefrerlaqrsttlrpfeittmvtmikesnqlffettinnqikdhrlrvlfptgmvtetheadsiy evvtrpnqvsdtwenptnpqhqqafvnvhdqnkgvtifneglneyevladgtiavtlircvgelgdwgy fatpeaqcqgeytfkyglslhgkpeerfatyqqaysaqipftaattarhegklapnhvylttaegpigw tavkrqeqtnhlvvrgfnltaqnipcelhketqpatcltnvleepltpaievdaplrpfeirtwrfek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.282
    Matthews' coefficent 2.33 Rfactor 0.222
    Waters 40 Solvent Content 47.20

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3lvt
    1. The molecular characterization of a novel GH38 [alpha]-mannosidase from the crenarchaeon Sulfolobus solfataricus revealed its ability in de-mannosylating
    B Cobucci-Ponzano, F Conte, A Strazzulli, C Capasso - Biochimie, 2010 - Elsevier
     
    2. Characterisation of Human Neutral and Lysosomal alpha-Mannosidases
    E Kuokkanen - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch