The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative aldolase from Klebsiella pneumoniae. To be Published
    Site MCSG
    PDB Id 3m0z Target Id APC38300
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS33248,ABR79991.1, PF07071.1.HMM.1, 272620 Molecular Weight 26133.47 Da.
    Residues 246 Isoelectric Point 5.96
    Sequence mkltpnfyrdrvclnvlagskdnareiydaaeghvlvgvlsknypdvasavvdmrdyaklidnalsvgl gagdpnqsamvseisrqvqpqhvnqvftgvatsrallgqnetvvnglvsptgtpgmvkistgplssgaa dgivpletaiallkdmggssikyfpmgglkhraefeavakacaahdfwleptggidlenyseilkiald agvskiiphiyssiidkasgntrpadvrqllemtkqlvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.20 Rfree 0.15487
    Matthews' coefficent 2.20 Rfactor 0.12621
    Waters 1600 Solvent Content 44.14

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch