.
The Open Protein Structure Annotation Network
PDB Keyword
.

3maj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative DNA processing protein DprA from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3maj Target Id APC65212
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS33280,NP_948459.1, 3.40.50.450, 258594 Molecular Weight 39846.96 Da.
    Residues 380 Isoelectric Point 6.12
    Sequence mdvgerssdqgttvlteaqridwmrliraenvgprtfrslinhfgsaraalerlpelarrggaaragri psedearreieagrrigvelvapgetgyptrlatiddappllgvhalpealavmarpmiaivgsrnasg aglkfagqlaadlgaagfvvisglargidqaahraslssgtvavlagghdkiypaehedllldiiqtrg aaisemplghvprgkdfprrnrlisgasvgvavieaayrsgslitarraadqgrevfavpgspldpraa gtndlikqgatlitsasdiveavasilerpielpgrepehappegepdtgdrtrilallgpspvgiddl irlsgispavvrtillelelagrlerhggslvsls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.23182
    Matthews' coefficent 2.23 Rfactor 0.18444
    Waters 143 Solvent Content 44.93

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3maj
    1. Structurefunction analysis of pneumococcal DprA protein reveals that dimerization is crucial for loading RecA recombinase onto DNA during transformation
    S Quevillon-Cheruel, N Campo - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch