.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mcz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of an O-methyltransferase family protein from Burkholderia thailandensis. TO BE PUBLISHED
    Site MCSG
    PDB Id 3mcz Target Id APC38945
    Molecular Characteristics
    Source Burkholderia thailandensis e264
    Alias Ids TPS33251,ABC36088.1, 3.40.50.150, 271848 Molecular Weight 38417.47 Da.
    Residues 350 Isoelectric Point 5.71
    Sequence mnasavetiyestedkaaltsvvdlvklsdqyrqsailhyavadklfdltqtgrtpaevaasfgmvegk aaillhalaalglltkegdafrntalteryltttsadyigpivehqylqwdnwprlgeilrsekplafq qesrfahdtrardafndamvrlsqpmvdvvselgvfarartvidlagghgtylaqvlrrhpqltgqiwd lpttrdaarktihahdlggrveffeknlldarnfeggaadvvmlndclhyfdarearevighaaglvkp ggalliltmtmnddrvtpalsadfslhmmvntnhgelhptpwiagvvrdaglavgersigrytlligqr ssgev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.192
    Matthews' coefficent 1.97 Rfactor 0.149
    Waters 451 Solvent Content 37.69

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch