.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mfd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of the Beta-lactamase superfamily domain of D-alanyl-D-alanine carboxypeptidase from Bacillus subtilis. TO BE PUBLISHED
    Site MCSG
    PDB Id 3mfd Target Id APC37676.1
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS48581,ZP_03592083.1, 224308 Molecular Weight 37363.09 Da.
    Residues 331 Isoelectric Point 9.07
    Sequence aidvsaksaiiidgasgrvlyakdehqkrriasitkimtavlaiesgkmdqtvtvsanavrtegsaiyl tegqkvklkdlvyglmlrsgndaavaiaehvggsldgfvymmnqkaeqlgmkntrfqnphglddhenhy staydmailtkyamklkdyqkisgtkiykaetmesvwknknklltmlypystggktgytklakrtlvst askdgidliavtindpndwddhmkmfnyvfehyqtyliakkgdipklkgtfyeskafikrditylltee ekenvkinttllkpkkawekdaskipdivghmeimfndatiakvpiyyenerhqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.19014
    Matthews' coefficent 2.83 Rfactor 0.16456
    Waters 773 Solvent Content 56.46

    Ligand Information
    Ligands CIT (CITRIC) x 4;EDO (1,2-ETHANEDIOL) x 8
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch