.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mfn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Dfer_2879 protein of unknown function from Dyadobacter fermentans. To be Published
    Site MCSG
    PDB Id 3mfn Target Id APC41694.0
    Molecular Characteristics
    Source 471854
    Alias Ids TPS48614,YP_003087259, 471854 Molecular Weight 15236.70 Da.
    Residues 133 Isoelectric Point 8.96
    Sequence mikkqelsaqeavieakrylnnakdilrdkggkedgfyqdskyvkmaghtaysgvlfaldhyfgkktkg rkdvdwyksnlaqqdkkilntfvsvyeqlhlvmaydgvgdaevvklgfqraeiiidwverrlaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.02 Rfree 0.227
    Matthews' coefficent 1.88 Rfactor 0.188
    Waters 146 Solvent Content 34.69

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch