.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mlf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative transcriptional regulator from Staphylococcus aureus. To be Published
    Site MCSG
    PDB Id 3mlf Target Id APC67079.0
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus usa300_tch1516
    Alias Ids TPS48647,YP_001575881, 451516 Molecular Weight 10174.11 Da.
    Residues 87 Isoelectric Point 8.80
    Sequence mktlkelrtdygltqkelgdlfkvssrtiqnmekdstnikdsllskymsafnvkyddiflgneyenfvf tndkkksiilafkekqts
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.248
    Matthews' coefficent 3.37 Rfactor 0.208
    Waters 128 Solvent Content 63.53

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch