.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mn2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a probable AraC family transcriptional regulator from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 3mn2 Target Id APC66556.1
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS48643,CAE26011, 258594 Molecular Weight 11800.83 Da.
    Residues 105 Isoelectric Point 10.11
    Sequence vrqveeyieanwmrpitiekltaltgissrgifkafqrsrgyspmafakrvrlqhahnllsdgatpttv taaalscgfsnlghfardyrdmfgekpsetlqrarp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2475
    Matthews' coefficent 2.14 Rfactor 0.1985
    Waters 141 Solvent Content 42.39

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3mn2
    1. Computer-Based Annotation of Putative AraC/XylS-Family Transcription Factors of Known Structure but Unknown Function
    A Schller, AW Slater, T Norambuena - Journal of Biomedicine , 2012 - hindawi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch