.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mo4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697. To be Published
    Site MCSG
    PDB Id 3mo4 Target Id APC40139
    Molecular Characteristics
    Source Bifidobacterium longum subsp. infantis atcc 15697
    Alias Ids TPS48601,391904 Molecular Weight 53031.28 Da.
    Residues 478 Isoelectric Point 5.05
    Sequence mnnpadaginlnylanvrpssrqlawqrmemyaflhfgmntmtdrewglghedpalfnprnvdvdqwmd alvaggmagviltckhhdgfclwpsrltrhtvasspwregkgdlvrevsesarrhglkfgvylspwdrt eesygkgkayddfyvgqltelltqygpifsvwldgangegkngktqyydwdryynvirslqpdavisvc gpdvrwagneaghvrdnewsvvprrlrsaeltmeksqqeddasfattvssqdddlgsreavagygdnvc wypaevdtsirpgwfyhqseddkvmsadqlfdlwlsavggnsslllnippspegllaepdvqslkglgr rvsefrealasvrceartssasaaaahlvdgnrdtfwrpdaddaapaitltlpqpttinaivieeaieh gqriehlrvtgalpdgtervlgqagtvgyrrilrfddvevssvtlhvdgsrlapmisraaavri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2052
    Matthews' coefficent 2.49 Rfactor 0.1620
    Waters 813 Solvent Content 50.69

    Ligand Information
    Ligands TYR (FORMIC) x 1;FMT x 1
    Metals

    Jmol

     
    Google Scholar output for 3mo4
    1. Bifidobacterium longum subsp. infantis ATCC 15697 _-Fucosidases Are Active on Fucosylated Human Milk Oligosaccharides
    DA Sela, D Garrido, L Lerno, S Wu, K Tan - Applied and , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch