.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Protein DUF1054 from Pink Subaerial Biofilm Microbial Leptospirillum sp. Group II UBA. To be Published
    Site MCSG
    PDB Id 3mqz Target Id APC41548.0
    Molecular Characteristics
    Source Leptospirillum sp. group ii uba
    Alias Ids TPS48613,EAY58270, 419542 Molecular Weight 24117.39 Da.
    Residues 212 Isoelectric Point 9.51
    Sequence msvqtierlqdyllpewvsifdiadfsgrmlrirgdirpallrlasrlaellnespgprpwyphvashm rrrvnpppetwlalgpekrgyksyahsgvfiggrglsvrfilkdeaieerknlgrwmsrsgpafeqwkk kvgdlrdfgpvhddpmadppkvewdprvfgerlgslksasldigfrvtfdtslagivktirtfdllyae aekgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.1739
    Matthews' coefficent 1.88 Rfactor 0.1483
    Waters 309 Solvent Content 34.42

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3mqz
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch