.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Sensory Box Histidine Kinase/Response Regulator from Burkholderia thailandensis E264. To be Published
    Site MCSG
    PDB Id 3mr0 Target Id APC67421.1
    Molecular Characteristics
    Source Burkholderia thailandensis e264
    Alias Ids TPS48653,ABC33969, 271848 Molecular Weight 16238.31 Da.
    Residues 139 Isoelectric Point 6.33
    Sequence lsaseerfqlavsgasaglwdwnpktgamylsphfkkimgyedhelpdeitghresihpddrarvlaal kahlehrdtydveyrvrtrsgdfrwiqsrgqalwnsagepyrmvgwimdvtdrkrdedalrvsreelrrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.49 Rfree 0.192
    Matthews' coefficent 2.22 Rfactor 0.164
    Waters 358 Solvent Content 44.52

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 6;GOL (GLYCEROL) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 4;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3mr0
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch