.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mr7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Adenylate/Guanylate Cyclase/Hydrolase from Silicibacter pomeroyi. To be Published
    Site MCSG
    PDB Id 3mr7 Target Id APC36678.1
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS48577,AAV96260.1, 3.30.70.1230, 246200 Molecular Weight 20952.56 Da.
    Residues 186 Isoelectric Point 5.26
    Sequence errlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgmlarfdtaqaalr caleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaarleaisepgaicvsdivhqi tqdrvsepftdlglqkvknitrpirvwqwvpdadrdqshdpqpshvqh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.246
    Matthews' coefficent 2.29 Rfactor 0.177
    Waters 63 Solvent Content 46.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mr7
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    2. A Computational Framework for Inferring Structure, Function, and Evolution of Proteins
    Y Hong - 2010 - etda.libraries.psu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch