.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mt0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein PA1789 from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 3mt0 Target Id APC67739.0
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS48657,AAG05178, 208964 Molecular Weight 31271.89 Da.
    Residues 287 Isoelectric Point 5.36
    Sequence mqairsilvviepdqleglalkraqliagvtqshlhllvcekrrdhsaalndlaqelreegysvstnqa wkdslhqtiiaeqqaegcgliikqhfpdnplkkailtpddwkllrfapcpvlmtktarpwtggkilaav dvgnndgehrslhagiishaydiaglakatlhvisahpspmlssadptfqlsetiearyreacrtfqae ygfsdeqlhieegpadvliprtaqkldavvtvigtvartglsgaligntaevvldtlesdvlvlkpddi iahleelaske
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.58 Rfree 0.2036
    Matthews' coefficent 2.05 Rfactor 0.1761
    Waters 222 Solvent Content 39.97

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch