.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mt1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative carboxynorspermidine decarboxylase protein from Sinorhizobium meliloti. To be Published
    Site MCSG
    PDB Id 3mt1 Target Id APC65365
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS48640,NP_438090.1, 2.40.37.10, 266834 Molecular Weight 41087.36 Da.
    Residues 365 Isoelectric Point 5.35
    Sequence mietpyylidkakltrnmeriahvreksgakallalkcfatwsvfdlmrdymdgttssslfevrlgrer fgkethaysvaygdneidevvshadkiifnsisqlerfadkaagiarglrlnpqvssssfdladparpf srlgewdvpkvervmdringfmihnncenkdfglfdrmlgeieerfgaliarvdwvslgggihftgddy pvdafsarlrafsdrygvqiylepgeasitksttlevtvldtlyngknlaivdssieahmldlliyret akvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiairel dgsvrtvreftyadyeqsls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.25574
    Matthews' coefficent 2.06 Rfactor 0.19023
    Waters 61 Solvent Content 40.27

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3mt1
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch