.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mtj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Homoserine Dehydrogenase from Thiobacillus denitrificans to 2.15A. To be Published
    Site MCSG
    PDB Id 3mtj Target Id APC40289
    Molecular Characteristics
    Source Thiobacillus denitrificans atcc 25259
    Alias Ids TPS48605,YP_314601.1, 292415 Molecular Weight 47054.52 Da.
    Residues 437 Isoelectric Point 5.51
    Sequence mkpihvgllglgtvgggtltvlrrnaeeitrragreirvvraavrnldkaealagglplttnpfdvvdd peidivveliggleparelvmqaiangkhvvtankhlvakygneifaaaqakgvmvtfeaavaggipii kalregltanriewlagiingtsnfilsemrdkgaafddvlkeaqrlgyaeadptfdiegidaahklti lsaiafgipmqferaytegisqltredvryaeelgyrikllgiarraengielrvhptliperrlianv dgamnavlvkgdavgptlyygagagseptasavvadlvdvtrlhtadphhrvphlafqpdqladtpilp meavrtayylrlrafdrpgvladitriladssisidamvqkepaegeeqvdiillthvtleknvnaaia kiealdavagkvmrirledlgak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.256
    Matthews' coefficent 2.72 Rfactor 0.217
    Waters 113 Solvent Content 54.90

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch