.
The Open Protein Structure Annotation Network
PDB Keyword
.

3muq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved functionally unknown protein from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3muq Target Id APC64288.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS48639,BAC59763.1, 3.40.190.10, 223926 Molecular Weight 26072.27 Da.
    Residues 234 Isoelectric Point 5.64
    Sequence aehvrlatttstyhsglldyllpqfekdtgykvdviaagtgkalkmgengdvdlvmthapkaegtfvek gygvlprklmyndfvivgpkadpakikddesvldvfkeianknatfisrgddsgthkkemgfwaqtkie pnfggyrsvgqgmgptlnmasemqgytmsdrgtwlayqnkldleilfqgdeklfnpyqvilvnperypt inyqgakafsdwlvnprgqelingfrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.2066
    Matthews' coefficent 2.82 Rfactor 0.1642
    Waters 307 Solvent Content 56.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch