.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mvk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of FucU from Bifidobacterium longum to 1.65A. To be Published
    Site MCSG
    PDB Id 3mvk Target Id APC40147
    Molecular Characteristics
    Source Bifidobacterium longum subsp. infantis atcc 15697
    Alias Ids TPS48602,391904 Molecular Weight 15942.55 Da.
    Residues 148 Isoelectric Point 4.92
    Sequence mlkgipkiippellkvlcemghgdqlviadgnfpaesigknaivvrmdghgggeilkailtvfpldtyv dkpatlmekvpgdtvatpiwdvyaglikehdergadaigslerfafyeqaknaycviasgesaqyanli lqkgvvfnae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 1.65 Rfree 0.205
    Matthews' coefficent 2.50 Rfactor 0.182
    Waters 1317 Solvent Content 50.90

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 11;GOL (GLYCEROL) x 6
    Metals NA (SODIUM) x 15

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch