.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mvn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a domain from a putative UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-medo-diaminopimelate ligase from Haemophilus ducreyi 35000HP. To be Published
    Site MCSG
    PDB Id 3mvn Target Id APC36461.1
    Molecular Characteristics
    Source Haemophilus ducreyi 35000hp
    Alias Ids TPS48571,AAP95619.1, 3.90.190.20, 233412 Molecular Weight 15313.75 Da.
    Residues 139 Isoelectric Point 6.04
    Sequence qrrlevkgvvnnitvyddfahhptaitatidalrakvgqqrilavleprsntmkmgvhkhelatslqda dsvfiyqpptiewqvsevlanlaqpaisaddvdelvmrivqqakpndhilimsngafggihqklltalan
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23707
    Matthews' coefficent 1.61 Rfactor 0.15880
    Waters 68 Solvent Content 23.69

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch