.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mvp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a TetR/AcrR transcriptional regulator from Streptococcus mutans to 1.85A. To be Published
    Site MCSG
    PDB Id 3mvp Target Id APC41410.0
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS48609,NP_720607, 210007 Molecular Weight 25235.62 Da.
    Residues 217 Isoelectric Point 8.41
    Sequence msnfekrnrkmaeknirkpkqersiekrnkilqvakdlfsdktyfnvttneiakkadvsvgtlyayfas kediltallkryndfflttifadinsqdsldrfkknpkewlnvlinqllaaedkifhaqiemlayaipq akalleehnnnlknltykcllyysdqaanpsfktlslvvfdfisalvdellyhehtqeeahqikktgid sldliiksyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.259
    Matthews' coefficent 2.21 Rfactor 0.221
    Waters 183 Solvent Content 44.50

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch