.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mw6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein NMB1681 from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 3mw6 Target Id APC83807
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5715,AAF42029.1, 122586 Molecular Weight 15498.80 Da.
    Residues 141 Isoelectric Point 8.71
    Sequence mtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaaliarvla nhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalqqqsaqaaaetlsveaeaaess aae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.2348
    Matthews' coefficent 2.77 Rfactor 0.1906
    Waters 170 Solvent Content 55.62

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3mw6
    1. N. meningitidis 1681 is a member of the FinO family of RNA chaperones
    S Chaulk, J Lu, K Tan, DC Arthur, RA Edwards - RNA biology, 2010 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch