.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mxq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sensory box sensor histidine kinase from Vibrio cholerae. To be Published
    Site MCSG
    PDB Id 3mxq Target Id APC87472.1
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS48676,AAF94243.1, BIG_1197.1, 243277 Molecular Weight 15616.97 Da.
    Residues 136 Isoelectric Point 4.72
    Sequence maksrlllselldqlsfalcivrndyvivkvneyfesrvifdgetmqgknilelfpesadylkrkidta lviesssfssweqkphllpfkssrpvsgeeeqmyqnlevipihsedgtiehvclcvydvtiqasqqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.78 Rfree 0.25743
    Matthews' coefficent 2.56 Rfactor 0.22547
    Waters 5 Solvent Content 52.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch