.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n04

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title THE CRYSTAL STRUCTURE OF THE alpha-Glucosidase (FAMILY 31) FROM RUMINOCOCCUS OBEUM ATCC 29174. TO BE PUBLISHED
    Site MCSG
    PDB Id 3n04 Target Id APC21248
    Related PDB Ids 3mkk 3nsx 3nxm 3m6d 3m46 3nuk 3nqq 
    Molecular Characteristics
    Source Ruminococcus obeum atcc 29174
    Alias Ids TPS25106,FB2QIBBRN6VLLWFOPTBU7UQOV1A, 411459 Molecular Weight 77079.38 Da.
    Residues 663 Isoelectric Point 4.99
    Sequence mirkyrygapfdtealtekietaeeafpygeisqkegfaftyimdeddivyglgesnrginkrgycyis nctddpihtedkrslygahnfiivsgkttfglffdypskltfdigytrmdtlkvscenadldiyviege naydivkqfrrvigrsyippkfafgfgqsrwgyttkedfravakgyrenhipidmiymdidymqdfkdf tvneknfpdfpefvkemkdqelrlipiidagvkvekgyevyeegvknnyfckredgsdfvaavwpgdth fpdmlnpearkwfgdkyrflidqgiegfwndmnepaifysseglaeakefagefakdtegkihpwamqa kmkdivnspedykrfyhnvngkkirhdkvhnlfgynmtraageaferidpekrflmfsrssyigmhryg giwmgdnkswwshillnlkmlpslnmcgfmytgadlggfgddttrdlllrflalgvftplmrdhaaegt reqecyqfeniedfrsvinaryrlvpylyseymkaalnddmyfkplgfvypddkmairvedqlmlgnei miapvyeqnargryvylpeemkfikfmpdgsiseevlekgvhyvdvalnevplfirsgkcipvaeaaec vkdidtenmqligyegssytlyeddgihkdydkkenyrvltk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.02 Rfree 0.20675
    Matthews' coefficent 2.31 Rfactor 0.16839
    Waters 824 Solvent Content 46.67

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3n04
    1. Novel _-glucosidase from human gut microbiome: substrate specificities and their switch
    K Tan, C Tesar, R Wilton, L Keigher, G Babnigg - The FASEB Journal, 2010 - FASEB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch