.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n2q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Sex pheromone staph-cAM373 precursor. To be Published
    Site MCSG
    PDB Id 3n2q Target Id APC25140.1
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS48561,AAP11582.1, PF07537.1.HMM.1, 226900 Molecular Weight 31605.14 Da.
    Residues 284 Isoelectric Point 5.32
    Sequence plkeqkvintaniktnskldlaeyengliniatqqfdteshvlqlnqyipeklidelvakveapvltni ieqdyfgkqnsnelslsgvmiglamsssvsneeamskgtevakqlieainkndkynkspitfaifkqes tsslkngtyiasatvqkndtnlgnwstideksysypsdeftqahgedntkinnfakeikgfsngdfipv nakvsykkdqmdtlnmnivikyngktelmaltqlaaqgmldklpkdakvqlqikseskieaviikekns dkpfvsfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.27274
    Matthews' coefficent 2.71 Rfactor 0.21491
    Waters 37 Solvent Content 54.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch