.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n3t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Diguanylate Cyclase/Phosphodiesterase Complex with Cyclic Di-Gmp. To be Published
    Site MCSG
    PDB Id 3n3t Target Id APC7542
    Related PDB Ids 2r6o 
    Molecular Characteristics
    Source Thiobacillus denitrificans atcc 25259
    Alias Ids TPS5150,YP_315023.1, 292415 Molecular Weight 29990.41 Da.
    Residues 272 Isoelectric Point 5.14
    Sequence erltldtrlrqalernelvlhyqpivelasgrivggealvrwedperglvmpsafipaaedtglivals dwvleacctqlrawqqqgraaddltlsvnistrqfegehltravdralarsglrpdcleleitenvmlv mtdevrtcldalrargvrlalddfgtgysslsylsqlpfhglkidqsfvrkipahpsetqivttilala rglgmevvaegietaqqyaflrdrgcefgqgnlmstpqaadafaslldrqkasgqrpvhghetap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.25363
    Matthews' coefficent 2.16 Rfactor 0.18403
    Waters 225 Solvent Content 42.94

    Ligand Information
    Ligands C2E (9,9'-[(2R,3R,3AS,5S,7AR,9R,10R,10AS,12S,14AR)-3,5,10,) x 2
    Metals CL (CHLORIDE) x 1;MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 3n3t
    1. Structural insight into the mechanism of c-di-GMP hydrolysis by EAL domain phosphodiesterases
    A Tchigvintsev, X Xu, A Singer, C Chang - Journal of molecular , 2010 - Elsevier
     
    2. Conservative change to the phosphate moiety of cyclic diguanylic monophosphate remarkably affects its polymorphism and ability to bind DGC, PDE, and PilZ
    J Wang, J Zhou, GP Donaldson - Journal of the , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch