.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n7z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acetyltransferase from Bacillus anthracis. To be Published
    Site MCSG
    PDB Id 3n7z Target Id APC68255.1
    Molecular Characteristics
    Source Bacillus anthracis str. sterne
    Alias Ids TPS48658,YP_029001, 260799 Molecular Weight 45473.09 Da.
    Residues 385 Isoelectric Point 5.59
    Sequence mnvirlkedkfrealrlseyafqykvdedrlqqqitkmkeshevygimegenlaaklhlipfhiyigke kfkmggvagvatypeyrrsgyvkellqhslqtmkkdgytvsmlhpfavsfyrkygwelcanllvchmtk sdlvmkkqvngtvkrfnkeshpeeveklyetfaelfsgmlvrnekwwlqavyddltlaiyydenqtaag ymlykienykmtveefvplhnearnglwnficqhdsmikdlemtvsenepllytlqeprvkteikpyfm grivdveqflkqyelnwnnvqqevilhitdsfaqwnnitvrianheitiieepidkgikldinalstil fgyrrplelnelelisgseeeirafesvvpvrkpfiydff
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.75 Rfree 0.24238
    Matthews' coefficent 2.67 Rfactor 0.18725
    Waters 92 Solvent Content 53.88

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch