.
The Open Protein Structure Annotation Network
PDB Keyword
.

3na2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crsystal Structure of Protein of Unknown Function from Mine Drainage Metagenome Leptospirillum rubarum. To be Published
    Site MCSG
    PDB Id 3na2 Target Id APC41480.0
    Molecular Characteristics
    Source Leptospirillum sp. group ii uba
    Alias Ids TPS48611,EAY56613, 419542 Molecular Weight 16617.28 Da.
    Residues 148 Isoelectric Point 5.66
    Sequence vepgvtdrigqmilemfrtgmclfsvrspggvaelyggearkveitgtsltieredwhlhckletvetv vfdlspkdnggirmavvfrdkhqapvlraawlprlmpetpsppeqfwaftqryidlpmvvdarnrqlvf pgsgqggfte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.29 Rfree 0.248
    Matthews' coefficent 2.05 Rfactor 0.186
    Waters 147 Solvent Content 40.10

    Ligand Information
    Ligands ACY (ACETIC) x 2;PEG (DI(HYDROXYETHYL)ETHER) x 2
    Metals

    Jmol

     
    Google Scholar output for 3na2
    1. Assessment of template based protein structure predictions in CASP9
    V Mariani, F Kiefer, T Schmidt, J Haas - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Assessment of protein structure refinement in CASP9
    JL MacCallum, A Prez, MJ Schnieders - Proteins: Structure, , 2011 - Wiley Online Library
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch